SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G19790.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G19790.1
Domain Number 1 Region: 21-78
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-19
Family GCC-box binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G19790.1
Sequence length 253
Sequence
MEHQTTPKQKTKEKSKGNKTKFVGVRQRPSGKWVAEIKDTTQKIRMWLGTFETAEEAARA
YDEAACLLRGSNTRTNFANHFPNNSQLSLKIRNLLHQKQSMKQQQQQQHKPVSSLTDCNI
NYISTATSLTTTTTTTTTTAIPLNNVYRPDSSVIGQPETEGLQLPYSWPLVSGFNHQIPL
AQAGGETHGHLNDHYSTDQHLGLAEIERQISASLYAMNGANSYYDNMNAEYAIFDPTDPI
WDLPSLSQLFCPT
Download sequence
Identical sequences Q6J9S1
3702.AT5G19790.1-P AT5G19790.1 AT5G19790.1 NP_197480.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]