SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G25190.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G25190.1
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily DNA-binding domain 1.05e-20
Family GCC-box binding domain 0.00027
Further Details:      
 
Weak hits

Sequence:  AT5G25190.1
Domain Number - Region: 90-148
Classification Level Classification E-value
Superfamily YehR-like 0.0445
Family YehR-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G25190.1
Sequence length 181
Sequence
MARPQQRFRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDEAARLMCGPRAR
TNFPYNPNAIPTSSSKLLSATLTAKLHKCYMASLQMTKQTQTQTQTQTARSQSADSDGVT
ANESHLNRGVTETTEIKWEDGNANMQQNFRPLEEDHIEQMIEELLHYGSIELCSVLPTQT
L
Download sequence
Identical sequences A0A178UBV4 Q94AW5
AT5G25190.1 AT5G25190.1 3702.AT5G25190.1-P NP_197901.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]