SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G32460.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G32460.1
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-17
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 427-514
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000114
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 3 Region: 145-236
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000412
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 4 Region: 295-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000126
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G32460.1
Sequence length 530
Sequence
MTDAMFSSSAKPHFIKPMLPGFETYIVIPKAFYSNYLEGRQEGNAAELRSDATEITWKIK
IDGRRMTKGWEEFAVAHNLQVDDILVFRHEGNLLFHVTPFGLSFCEILYSQRDEKDVKDT
TGKVTRSRTVKKNGKNECSSVDTDFVVPVTASNQRVDSFYLPRGFTTSSGSSKLCNEIIL
IDEKDRPSTLKLRYNKSSNRFCVSRGWRAFCCRNGYRTGCFLRIILVRKGKTPVLRIFPL
ERDEDNIEKHSKKVKQEVEHEESVKEETNVESGKLKRDRLLQKDPKNLCSTSQDTNFVVP
VTASNQRHDSFHLPKGLTTSSGLSKLCKKIIFMDQKGRSSILDLSYSISDDRFTVRRGWK
AFCCRNEHKTGCFLRLILVQNGKTPVLRIFPLERYENSIAKNSKKIKQEVEYESAKEEKN
LESLSLSDNSSFVVSVTVSNLSEDILHLPIRLSRSNLLDKKIHEIVLMNKEGRTWILSLK
YSKYSGRFRITRGWKSFCEANGQKPGCTFLLKLHLSMTRFDQDGVAWDKK
Download sequence
Identical sequences F4KFT6
3702.AT5G32460.1-P AT5G32460.1 NP_001154745.1.80155 AT5G32460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]