SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G35210.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G35210.1
Domain Number 1 Region: 402-463
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-16
Family PHD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1232-1290
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000354
Family PHD domain 0.0069
Further Details:      
 
Domain Number 3 Region: 1480-1538
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000175
Family PHD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G35210.1
Sequence length 1706
Sequence
MEAKVPRPRGRPRKRQRLEDDNRKLNNRGKKQVLEVEPAVPISLLGCYMLKDFDDNEVFL
GKIVSYDTGLYRVIYEDGDCEELESGDLRRLIISDSYLDDELRVRRKKLDKLILKKEEKK
KRNSPENKAVELPNQVNGVQARAVTNSEDGDSYSDSESSESGDKRGSDLEIEAPLVPPVD
LPPSSGTIGIPEEAVAHLLSVYGFLRSFSFQLYICPFELNDFVGALYFSGPNSLLDAVHV
ALLRALKGHLERLSSSKSVLASKCLRCIDWSLLDVLTWPVYLVQYFTAMGHASGPQWNIF
NKFVVEIEYYSLPIGMKLKILQILCDDIFDVADLRDEIDAREESEIGFDPDRVATGLLEN
VPRRVHPRFAKTSAYKEKEVTDSSTNESKDLDSRCTNGGSNEVSSDLDGNSDECRICGMD
GTLLCCDGCPLAYHSRCIGVVKMYIPDGPWFCPECTINKKGPKIAHGTSLRGAVQFGMDP
HGRLFLGTCNHLLVLNISVNGDAVVKYYNVNDISKVVLVLISASSHTLEYVEICKAITQY
WDLPEGISLREGEIGLTQAKDREDGKVSEITKSDSANISNRSHTQTVFDLPTSTLGNTNS
AVTGGSCGIQGKKLAARVTYLGLSFKPNTYNNHYTNGELAVSAAASLAVLSSEETHEPDL
RKYNSAKKAASSNILEQMKAFSLVAPRFFWPSPDKKEITRERCGWCHSCRLTSASRRGCM
LNAAVAGATKGAMKIFSGLFPLKNGEGVLSSIAAYILYLEESLRGLIAGPFLSESPRKQW
RKQVEEASTCKALKAPLLELEENICSIALSCDWFKQMDDWLIEHSIFQSAPVTLGVPQRR
GPGRTKQNTQAEVTAEGSDADSFTWWRGGKLSKVILLKAVLSQPATKKAAWQGGSKKIPG
LNYGDASYIPRRSRRSFWKAAVESSKNISQLALQVRYLDMSLRWRELVRPDQNLQNVKGP
ETDVAIFRNARICDKKLSDNKVSYGVFFGNQKHLPSRVMKNIMEVEKTQDRNEKYWLQEA
HVPLYLIKEFEESLHRVQMPSSTKKPSKKLSKLQRKQLKASLMDIFSYIASRRDKMEKCS
CASCDHDVLLRDTTTCSSCHGFCHKDCTSMSQHTNGNVEVLVTCKRCYLSKTRVPTNINH
RQSTAPQFTINVRHQNAVIPVIKVKPPSQQLSSQKPRENTSGVKQVTPDSSVSKSKQKTL
SCGVIWRKKNVEDTGVDFRNQNILLAGRSDKPSLEPVCGICLLPYNPGLTYIHCTKCEKW
FHTEAVKLKDSQIPEVVGFKCCKCRRIRSPDCPYMDPKLKEQKQIKRIVFTNQKQRQGNS
GLDSDSERMSEQKDSKPSTPLPATPLYPPDDVFIPEDDPLLVSVSKVKQITPSSFDLEWS
TTAFAPGPQKLPVRRQVKREDSDAAYPELHPIVKPEAEEQALPVLTEWDLSGELLFDYED
MEFEPQTYFSLTELLTADDSGGGQYQENGDMVVSGNPQFEPTEKEECEDDMGPCQRCLQM
DPAPDLLCTVCGLLIHSHCSPWSALPGSSWSCGQCRIRALGSITLGSFGAITQFKSILPD
RSTKVDISLAGPFAGAALSVSMFAVGLFLSTEPDAANDLVQVPSMLFQGSLLLGLISRAT
LGYAALHAATVSIHPLVIAGWCGLTTTAFNMLPVGCLDGGRAVQGAFGKNALVTFGLSTY
VMLGLRVLGGPLALPWGLYVLICRNT
Download sequence
Identical sequences F4JYC8
AT5G35210.1 AT5G35210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]