SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G35330.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G35330.2
Domain Number 1 Region: 97-214
Classification Level Classification E-value
Superfamily DNA-binding domain 3.92e-29
Family Methyl-CpG-binding domain, MBD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G35330.2
Sequence length 272
Sequence
MSMSQSRAVQRSSSPNEDRGENQLVVYDLKGNDDTEEEVLPVQSQPLSSRTQCPSIGAFT
VQCASCFKWRLMPSMQKYEEIREQLLENPFFCDTAREWKPDISCDVPADIYQDGTRLWAI
DKPNISRPPAGWQRLLRIRGEGGTRFADVYYVAPSGKKLRSTVEVQKYLNDNSEYIGEGV
KLSQFSFQIPKPLQDDYVRKRPARLLDSIDNTNTPVAKEANPLAWISPDDHISLQLGTPT
ESGLNNSHYQPSKKKKTSTLSIFGSNDELADR
Download sequence
Identical sequences A0A178U6X6 Q8LA53
AT5G35330.1 3702.AT5G35330.2-P AT5G35330.1 AT5G35330.2 AT5G35330.3 NP_001190421.1.80155 NP_001331130.1.80155 NP_198383.1.80155 NP_974850.1.80155 GO.25169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]