SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G36740.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G36740.1
Domain Number 1 Region: 643-694
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000598
Family PHD domain 0.0039
Further Details:      
 
Domain Number 2 Region: 845-934
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000646
Family N-acetyl transferase, NAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G36740.1
Sequence length 1179
Sequence
MLETNEQKGFDLNVCASIEDFSESDIKAEGETDSLVDGNVENVIEIKDKKKVIEREILIT
RRVLRSGSVARDLVNSDKHCKAVKRKGNVVSGGSSVDEVKEEVKQECVKSLVPEEIRGDD
FRSEVKVESKDDRSDDGKEEKVQRKRGRPRKFGMSSQSDDNGLISNCKLRTSLGKKKELV
GDDNVEKLVGGSCFNKEKAEVKLEHGEYAEDKEILGLDFRSQVKVEIKDDECGIVELHDE
ELQVKRKRGRPRKVQISSQSDESRPNTNCKLARTPELSSQSSVDRISLSRLRGRPPKTKE
TSVSLYIEKGPESNGRRMVRKRGRPPTPQKKRKSGMTDESDWKAKKRLKLCESPLESRHN
NPLIDDERMIGEQRSKQTEAGGHSRSKSKKMLSDRILQLLLTAGWTVEYRPRNGRAYQDA
VYLNPEGKTHWSVTKAYQVYKKQLESNPNDQKNSTTGSGFGLLPEEDLHLLERTIQKKRS
DTGKQRSKLKDRDTNDILVSTKGTGKIKREEKHSRKRCTPSARSSLKDVDSKEDGYILFE
GKRTMLGWMIDSTIVPLNGKVQCMDCKKTDILLEGIITKEGIRCNCCDEVFSVLDFEVHA
GGNRNQPFKSLYLEGGNSLLQCLHESMNKQSESQLKGYHFVDFGSGDPNDDTCGICGDGG
DLICCDGCPSTFHQSCLDIKKFPSGAWYCYNCSCKFCEKDEAAKHETSTLPSLSSCRLCE
EKCSKHYPHTLADHQACINQDGTVPGERSTDSFCGKYCQELFEELQLFIGVKHPLPEGFS
WSFLRRFELPSEVADCDISEKIAYNAKMAVAFSVMDECFSPLVDHRSGVNLLQNIVYNFG
SNFHRLDFSSFLTAVLERGDEIIAVASIRIHGNQLAEMPFIGTRYMYRRQGMCRRLMDGI
ESALGSLKVDKLVIPAVPELIDTWTSGFGFAPVNDSEKKTIKNLNLLVFPGVDMLGKSLV
KEKITDSVVSSPNGLVLLAPEMTLPVDVEENKPEESKDSAHERNCATAGVESPSNPVDSC
LKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVDDSHADQSDTKEQEI
DDKEDKTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGEELGNRTLALKREVT
PTLRASPRLIQRSWRTSRVNQKFTGTTNAVLLDSPHRCV
Download sequence
Identical sequences A0A178UK10
AT5G36740.1 AT5G36740.1 3702.AT5G36740.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]