SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G39550.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G39550.1
Domain Number 1 Region: 232-427
Classification Level Classification E-value
Superfamily PUA domain-like 1.02e-63
Family SRA domain-like 0.00000308
Further Details:      
 
Domain Number 2 Region: 126-191
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000707
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 489-578
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000133
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 4-62
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000137
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G39550.1
Sequence length 617
Sequence
MAIETQLPCDGDGVCMRCQVNPPSEETLTCGTCVTPWHVPCLLPESLASSTGEWECPDCS
GVVVPSAAPGTGNARPESSGSVLVAAIRAIQADETLTEAEKAKKRQKLMSGGGDDGVDEE
EKKKLEIFCSICIQLPERPITTPCGHNFCLKCFEKWAVGQGKLTCMICRSKIPRHVAKNP
RINLALVSAIRLANVTKCSVEATAAKVHHIIRNQDRPEKAFTTERAVKTGKANAASGKFF
VTIPRDHFGPIPAENDVTRKQGVLVGESWEDRQECRQWGAHFPHIAGIAGQSAVGAQSVA
LSGGYDDDEDHGEWFLYTGSGGRDLSGNKRINKKQSSDQAFKNMNESLRLSCKMGYPVRV
VRSWKEKRSAYAPAEGVRYDGVYRIEKCWSNVGVQGSFKVCRYLFVRCDNEPAPWTSDEH
GDRPRPLPNVPELETAADLFVRKESPSWDFDEAEGRWKWMKSPPVSRMALDPEERKKNKR
AKNTMKARLLKEFSCQICREVLSLPVTTPCAHNFCKACLEAKFAGITQLRERSNGGRKLR
AKKNIMTCPCCTTDLSEFLQNPQVNREMMEIIENFKKSEEEADASISEEEEEESEPPTKK
IKMDNNSVGGSGTSLSA
Download sequence
Identical sequences Q9FKA7
AT5G39550.1 3702.AT5G39550.1-P AT5G39550.1 NP_198771.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]