SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G41480.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G41480.1
Domain Number 1 Region: 75-367
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.52e-71
Family Folylpolyglutamate synthetase 0.0000211
Further Details:      
 
Domain Number 2 Region: 370-529
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 8.61e-16
Family Folylpolyglutamate synthetase, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G41480.1
Sequence length 530
Sequence
MRTLWNHFSTISYIKISPRMRRISAANLISNRNLSTISSTEDPELRDFVGFLESLKNYEK
SGVPKGAGTDSDDGFDLGRMKRLMLRLRNPHYKYKVVHVAGTKGKGSTSAFLSNILRAGG
YSVGCYSSPHILSIKERISCNGEPVSASTLNDLFYSVKPILEQSIQEENGSLSHFEILTG
IAFSLFEKENVDIAVIEAGLGGARDATNVIESSNLAASVITTIGEEHMAALGGSLESIAE
AKSGIIKHGRPVVLGGPFLPHIEGILRSKAASVSSSVILASNIGSSSSIKGIINKNGIGL
CQSCDIVIQNEKDDQPIVELSDVNLRMLGHHQLQNAVTATCVSLCLRDQGCGRVTDEAIR
IGLENTRLLGRSQFLTPKEAETLLLPGATVLLDGAHTKESARALKEMIKKDFPEKRLVFV
VAMASDKDHVSFAKELLSGLKPEAVILTEADIGGGKIRSTESSVLKESWIKAADELGSRS
MEASENKTVLGSLKLAYKILSDDTTSSDSGMVIVTGSLHIVSSVLASLQH
Download sequence
Identical sequences F4JYE9
AT5G41480.1 NP_198963.2.80155 3702.AT5G41480.1-P AT5G41480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]