SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G41950.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G41950.1
Domain Number 1 Region: 208-335
Classification Level Classification E-value
Superfamily TPR-like 7.96e-18
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  AT5G41950.1
Domain Number - Region: 449-549
Classification Level Classification E-value
Superfamily PH domain-like 0.00142
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G41950.1
Sequence length 565
Sequence
MADTVEEPQLQNGAAPAESETEQNPIPEPQLQTEPKLTGEIPEIEADLTPEEVQSEVTDA
KPEEVQSEVKPEEVKTVVTDAKPEEAQSEVKPEEVQSVVTDTKPDLTDVDLSPGGSEEIP
IRSTEVEQESTTSVLKKDDDGNKTFTMRELLSELKSEEGDGTPHSSASPFSRESASQPAE
NNPAMDLINRIQVNDEEGRSRQRVLAFAARKYASAIERNPDDHDALYNWALILQESADNV
SPDSVSPSKDDLLEEACKKYDEATRLCPTLYDAYYNWAIAISDRAKIRGRTKEAEELWEQ
AADNYEKAVQLNWNSSQALNNWGLVLQELSQIVPAREKEKVVRTAISKFRAAIRLQFDFH
RAIYNLGTVLYGLAEDTLRTGGSGNGKDMPPGELYSQSAIYIAAAHSLKPSYSVYSSALR
LVRSMLPLPHLKVGYLTAPPVGNSLAPHSDWKRTEFELNHERLLQVLKPEPREMGRNLSG
KAETMSTNVERKTVKVNITEIVSVTPCADLTLPPGAGLCIDTIHGPVFLVADSWESLDGW
LDAIRLVYTIYARGKSDVLAGIITG
Download sequence
Identical sequences Q9FHY8
AR3566 AT5G41950.1 3702.AT5G41950.1-P NP_199010.1.80155 AT5G41950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]