SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G43410.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G43410.1
Domain Number 1 Region: 14-74
Classification Level Classification E-value
Superfamily DNA-binding domain 1.32e-23
Family GCC-box binding domain 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G43410.1
Sequence length 131
Sequence
MDQGGRGVGAEHGKYRGVRRRPWGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAY
SMRGQAAILNFPHEYNMGSGVSSSTAMAGSSSASASASSSSRQVFEFEYLDDSVLEELLE
EGEKPNKGKKK
Download sequence
Identical sequences A0A178UK17 Q9LSX0
AT5G43410.1 3702.AT5G43410.1-P AT5G43410.1 NP_199154.1.80155 5wx9_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]