SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G45560.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G45560.1
Domain Number 1 Region: 191-368
Classification Level Classification E-value
Superfamily Bet v1-like 2.09e-41
Family STAR domain 0.007
Further Details:      
 
Domain Number 2 Region: 2-121
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000224
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G45560.1
Sequence length 719
Sequence
MSKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDNQLPIKTMVIDGNCRV
EDRGLKTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECVIDQHQDSLVPSG
QQYVSFEYKPGMDAGRTASSSDHESPFSALEDENDSQRDLLRRTTIGNGPPESILDWTKE
FDAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE
EIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYW
RRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDL
KGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALGKGGK
HHHKSSLSIDQTNGASRNSVLMDEDSDDDDEFQIPDSEPEPETSKQDQETDAKKTEEPAL
NIDLSCFSGNLRHDDNENARNCWRISDGNNFKVRGKSFCDDKRKIPAGKHLMDLVAVDWF
KDTKRMDHVVRRKGCAAQVAAEKGLFSTVVNVQVPGSTHYSMVFYFVTKELVPGSLFQRF
VDGDDEFRNSRLKLIPLVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSS
TVANGVLGLVIGVITSLVVEMAFLVQANTPEELPERLIGAVRVSHVELSSAIVPNLDSD
Download sequence
Identical sequences Q8VZF6
3702.AT5G45560.1-P AT5G45560.1 NP_199369.2.80155 AT5G45560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]