SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G47180.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G47180.1
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily PapD-like 3.66e-40
Family MSP-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G47180.1
Sequence length 220
Sequence
MTGVGENQLISIQPDELKFLFELEKQSYCDLKVANKTENYVAFKVKTTSPKKYFVRPNTG
VIQPWDSCIIRVTLQAQREYPPDMQCKDKFLLQSTIVPPHTDVDELPQDTFTKDSGKTLT
ECKLKVSYITPSTTQRSSESGATNGDGQSSETISTIQRLKEERDAAVKQTQQLQHELETV
RRRRNQRNSGNGLSLKLAAMVGLIGLIIGFILKLTLASPT
Download sequence
Identical sequences A0A178UAE4 Q9LVU1
NP_199529.1.80155 NP_851144.1.80155 AT5G47180.1 AT5G47180.2 3702.AT5G47180.1-P AT5G47180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]