SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G48090.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G48090.1
Domain Number 1 Region: 416-557
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000316
Family CAC2371-like 0.079
Further Details:      
 
Weak hits

Sequence:  AT5G48090.1
Domain Number - Region: 61-132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0035
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G48090.1
Sequence length 677
Sequence
MKRDEDLTKSKFLITFLGKTSQTTPIEVELPTDHLQDAQTPMEQDSIVENMTDEENSSSS
DDDSEANLQFDPVCSICDNGGYVLCCEGSCLRSFHPTIADGIETECESLGFTDKTQIQAL
GTYLCNNCLYKQHQCYACGELGSSDENFSQQVFPCSASNCGHFYHPECVARLLCADDQNK
AEELQAKIAARDCFACPLHTCKLCNMSEDKNQYACILLYADVAQQLITENVYLGILLLNS
TLTMRHCKELGKVCFLTTAFLYIVSFHKLLNRAHEIDGLILTPARDHLVFPDVSGQRRTR
SHGLAQFKEDVLGMETDHCHHEGLFTGLGITDPYEKPKKDISCDEVEQRVMGIIDEVESS
FNFDEFVKSRRPTHIKSYHSGNYFSKNITTGLVRTHVNAARAALKMFEEGRDRDARALFD
PDSLLQLMKHKKKLEISPFLHGMRYTSFGRHFTNPEKLKEIVERLHWYVENGDTVVDFCC
GSNDFSCLMKEKLMETGKICFYKNLDLIPPKNNFNFEMRDWLSVKEEELPDGSQLIMGLN
PPFGYKASLANTFIKKALEFKPKILILIVPSETKRVDAIDDYELIWEDRNLLAGMSFYLP
GSVDVNDKTIEQWNNITPPLYLWSRRDLSRSHKTTAVQQGHITQMHHFTYNGDSHHTEIP
QGDDDTDMVQDMEISPT
Download sequence
Identical sequences F4K064
3702.AT5G48090.1-P NP_199620.4.80155 AT5G48090.1 AT5G48090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]