SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G48090.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G48090.2
Domain Number 1 Region: 375-516
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000293
Family CAC2371-like 0.079
Further Details:      
 
Weak hits

Sequence:  AT5G48090.2
Domain Number - Region: 18-92
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00576
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G48090.2
Sequence length 636
Sequence
MEQDSIVENMTDEENSSSSDDDSEANLQFDPVCSICDNGGYVLCCEGSCLRSFHPTIADG
IETECESLGFTDKTQIQALGTYLCNNCLYKQHQCYACGELGSSDENFSQQVFPCSASNCG
HFYHPECVARLLCADDQNKAEELQAKIAARDCFACPLHTCKLCNMSEDKNQYACILLYAD
VAQQLITENVYLGILLLNSTLTMRHCKELGKVCFLTTAFLYIVSFHKLLNRAHEIDGLIL
TPARDHLVFPDVSGQRRTRSHGLAQFKEDVLGMETDHCHHEGLFTGLGITDPYEKPKKDI
SCDEVEQRVMGIIDEVESSFNFDEFVKSRRPTHIKSYHSGNYFSKNITTGLVRTHVNAAR
AALKMFEEGRDRDARALFDPDSLLQLMKHKKKLEISPFLHGMRYTSFGRHFTNPEKLKEI
VERLHWYVENGDTVVDFCCGSNDFSCLMKEKLMETGKICFYKNLDLIPPKNNFNFEMRDW
LSVKEEELPDGSQLIMGLNPPFGYKASLANTFIKKALEFKPKILILIVPSETKRVDAIDD
YELIWEDRNLLAGMSFYLPGSVDVNDKTIEQWNNITPPLYLWSRRDLSRSHKTTAVQQGH
ITQMHHFTYNGDSHHTEIPQGDDDTDMVQDMEISPT
Download sequence
Identical sequences Q9FI29
AT5G48090.2 NP_001154768.1.80155 NP_001318757.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]