SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G49580.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G49580.1
Domain Number 1 Region: 383-471
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-18
Family Chaperone J-domain 0.00085
Further Details:      
 
Weak hits

Sequence:  AT5G49580.1
Domain Number - Region: 517-554
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00691
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G49580.1
Sequence length 695
Sequence
MARKGSHQKNGMDNQTKQKKKTASDSLLSNKGQGKNNEAESVLKENCQDDKQTKSSPVCE
TLERDMDEAKGAASLKDIDQSVASESDLAGGSRPRNEPGFTTEETRYIPFGREHIDSVMR
SLLDILSTNSPSENIELAYNAVLRKLRISTATVSREMTKCMERHRPLIDSVKLRVYKGRD
LVLTKMRQVFPVVFRWLMHFGSIILLLSLVWLDCAIRGFDSFIRMGTASFFSIMWCGLFS
AFSMFGMTKFILISVATVLVALFIGFVVGSVTLAISGLVLLWLYGSFWTTLLFLFFGGLA
FMMKHERVALFIITVYSVYSALSYVGWLGLLLAFNLAFISTDALIYFFKNKINQQSTADR
PTEPVNDSSFENGPGFPGDRGPGVASTSGTDSELTSEDEIARLLNCPDHYSALGLARYGN
VDMAYLKREYRKKAMLVHPDKNMGNERAAEAFKKLQNAYEVLLDSVKQKSYDDELKREEL
LNYFRRFQNSSQKDTRGHGFSGSGFGSSEGEGEEAFRECRQIACKKCGNLHAWFLTKKSK
STARWCQDCKEFHQAKDGDGWVEQASQHVLFGLFQKVDMPRAYVCADSKIYEASQWYICQ
GMRCPANTHKPSFHVNMNATAAKRGTSGSSGQKGNQRMPNTNPDETMTEEEFYEWLQNAV
QSGMFDNARENPSSATASSTSSSSSKKKKKGKKQW
Download sequence
Identical sequences A0A178U973 Q9FGY8
AT5G49580.1 NP_001318769.1.80155 NP_199769.1.80155 3702.AT5G49580.1-P AT5G49580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]