SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G52230.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G52230.2
Domain Number - Region: 36-85
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000298
Family Methyl-CpG-binding domain, MBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G52230.2
Sequence length 746
Sequence
MNGEGISDGLSAERKVEIRVRKNGRKDKVIVEKSAAQGLPEGWIKKLEITNRSGRKTRRD
PFFIDPKSEYIFQSFKDASRYVETGNIGHYARKLKESDIEDDDSGNGKTVLRLEYVDKRS
ADDVLEKEKTIDDVRRSKRRNLSSSDEHSKNCKMTSDLSIVTSQVLEDLGKKEEVKDPIE
KQLIAKRVTRSQTKASTTEEVVVDLKRNLSSSNAKSEKDSVNSSVRSQKPKKEAVMKEEE
EQDSSEKRITRSKVEEKKNELSNSVARRTSKRLAGIELEPTPELKTRAKVQRIVPLDDEP
TPELKTRTKVQRVVPPDDEPTPELKTRTKIQRIVPPDDEPTLELKTRTKVQRILPPDDEL
TPELKSRTKVQRIVPPDDELTPEFKTRTKVQQRIPPDDGRAGKCKQPVNHVTTSGSKKTE
IPLNKEVAQSCNEQSSQKPHAAAATSNNRVSADSAVGIQNIGKAVGRKPSKDKKTLKSPL
IVYELNPVFHLDGYKQKEEMSPVSPLSCQTSATKCEKTAAGKRVGRSSPKANLTTSVKPT
QISPLRSPNKGKQPHPSDSGSAIQRRNKLANEYSNSSVVRGTCSEVMEKSTNSFSSAFDS
TLADLCKDPCIAFAIKTLTGESLCLLNTPAISSNPINNHTKQKGVSFTPETPGNVNTCSE
KLVFPSPPPGANIWQDPCIDFAIKTLTGAIPIGLDEPDTKSKSQGMTSTTAATQEAKGRQ
NNCDYMTNKTVGKPDDLRFTQSFSKD
Download sequence
Identical sequences Q9LTJ8
NP_001190520.1.80155 NP_001331264.1.80155 NP_200036.1.80155 AT5G52230.1 AT5G52230.2 AT5G52230.1 3702.AT5G52230.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]