SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G53310.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G53310.1
Domain Number - Region: 76-155
Classification Level Classification E-value
Superfamily PH domain-like 0.000568
Family Pleckstrin-homology domain (PH domain) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G53310.1
Sequence length 210
Sequence
MNRLKEQKGPKFDGEESPPPDFDEDRSVGEVDGGDHTPFAGGKVRRKASRYREHRGDYLH
VSSRPGLMRILEKQGDTSILFADKVLKFTGSGKMKRRIFILTDFAIYLIDPETEAMTRRI
ALSSVEKMCLSKLSDNFFAIIIPTEYDLFMASTRKTELVQVMVDVTKSASDYELEVLLSN
RFEYNASASLVKEVSFEESEGGIKTKFVWK
Download sequence
Identical sequences A0A178UGH0 Q9ASY2
3702.AT5G53310.1-P NP_568789.1.80155 AT5G53310.1 AT5G53310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]