SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G55390.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G55390.2
Domain Number - Region: 209-282
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000465
Family PHD domain 0.015
Further Details:      
 
Domain Number - Region: 704-809
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00113
Family N-6 DNA Methylase-like 0.087
Further Details:      
 
Domain Number - Region: 343-387
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0031
Family PHD domain 0.041
Further Details:      
 
Domain Number - Region: 283-354
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0691
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G55390.2
Sequence length 1297
Sequence
MTFVDDDEEEDFSVPQSASNYYFEDDDKEPVSFARLPIQWSVEEKVDGSGLGFYLRGRSD
NGLLPLHKLVKAWRYDLSNFQPEISVLTKDNIWIKLEEPRKSYGELIRTVLVTLHSIQFL
RRNPQASEKALWEKLTRSLRSYDVKPSQNDLVDHIGLIAEAAKRDRNLANSKFILAFLTK
KPTKRRLPDEDNAKDDFIVGDEDTYVASDEDELDDEDDDFFESVCAICDNGGEILCCEGS
CLRSFHATKKDGEDSLCDSLGFNKMQVEAIQKYFCPNCEHKIHQCFICKNLGSSDNSSGA
AEVFQCVSATCGYFYHPHCVTRRLRLGNKEESEALERQIIAGEYTCPLHKCSVCENGEVK
TDSNLQFAVCRRCPKSYHRKCLPREISFEDIEDEDILTRAWDGLLHNRVLIYCQEHEIDE
ELLTPVRDHVKFPFTEEQKVFVKEQRRILESHVGRDKARLKVKDPALQDTCGKASKNSFR
SSFPSSKDGFSTKKHGLVSSVPDHSRKRKDIDPSIKHKMVPQKSQKMMEDSREAGKNKLG
VKEARDAGKSKISLGERLFSYTQEPNPVKPGRVIPVDSKHNKTDSIASKEPGSEIPTLDN
DSQRRLLAVMKKATEEITMGTILKKFKIQSTMSTHSTRNVVDKTITMGKVEGSVQAIRTA
LKKLEEGGNIEDAKAVCEPEVLSQILKWKDKLKVYLAPFLHGARYTSFGRHFTNPEKLQQ
IVDRLHWYADDGDMIVDFCCGSNDFSCLMNAKLEETGKKCLYKNYDLFPAKNNFNFERKD
WMTVSKDELEPGSKLIMGLNPPFGVNASLANKFITKALEFRPKILILIVPPETERLDKKK
SSYVLIWEDKTFLSGNSFYLPGSVNEEDKQLEDWNLVPPPLSLWSRSDFAAKHKKIAEKH
CHLSRDVGSSKLKIVEEEANASLHPLGASDGMCDDIPMEKDELEVAECVNKILVSEKIDT
VETVARVHQSDHLSRRSQLKKEGKTKDYSGRKLGKSMDSNNVDWKSNDMEEDQGELSRAP
ESIKVKIPEMTSDWQSPVRSSPDDIYAVCTSISTTTPQRSHEAVEASLPAITRTKSNLGK
NIREHGCKVQGTGKPEVSRDRPSSVRTSREDIYTVRPSPENTGQKPFEAFEPSYGASLSH
FDDGLAAKYGGFGGGYRMPDPPFLPDQFPLRNGPNEMFDFRGYSDLDRGIGQREYPQQYG
GHLDPMLAPPPPPNLMDNAFPLQQRYAPHFDQMNYQRMSSFPPQPPLQPSGHNLLNPHDF
PLPPPPPSDFEMSPRGFAPGPNPNYPYMSRSGGWIND
Download sequence
Identical sequences F4K3G5
AT5G55390.1 AT5G55390.1 AT5G55390.2 3702.AT5G55390.1-P NP_001190545.1.80155 NP_001332152.1.80155 NP_200350.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]