SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G55800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G55800.1
Domain Number 1 Region: 148-240
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.19e-18
Family C1-like domain 0.081
Further Details:      
 
Domain Number 2 Region: 263-289,319-381
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.1e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.094
Further Details:      
 
Domain Number 3 Region: 472-523
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000942
Family C1-like domain 0.069
Further Details:      
 
Domain Number 4 Region: 448-491,546-577
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000259
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.026
Further Details:      
 
Weak hits

Sequence:  AT5G55800.1
Domain Number - Region: 85-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000153
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G55800.1
Sequence length 578
Sequence
MDSGGHKLPLQPLFSCPSSRINFHKRNHIDGHETQEFYPFNCSPHFPSKRTSTDQEGESF
LDWDNPYICKLPVVLLFWCNTEQPDPEDFRCGACGRPTLSATYYACLICEKMFHKECVES
PFEIIHPSHPFHSLRLTSSPQSQNCICCHHYFNDIFYHCSTCKLIMHPICAMRSIPFAVD
HPKSHSHPLTFYPAQASLVCHFCASIKKFDPTYICIQCVFAIHKDCRGFPHVIRISRHHH
RISFTSSLLSGTFSCGVCREQVDNNYGAYACNKCDGYFVHSKCAIDPKVWDGKELEGVPE
ENDKIDDGEPFKRIADGIILHPFHSHHLQLEIFRAYDENTYCRGCALPIYEGQFYSCMEC
DFILHESCANAPCMKRHPLHPYPLTLLNTASPGEESVSQCTACRRLVVGFYYFHYLDKHH
ERIALDLRCASIIEPFEFHGHKHPLYLPWEDSNKVTHCQICKEDFDMDSLEVNCMECDYT
ICFHCASLPEKVRYKHDSHFLMICDGKEASDKPYWCEICEGKIEVVKEKANSGDKKKKRL
PTNRDKKERKIYKCNDCCTTLHAECLLGQTFTSNLLKQ
Download sequence
Identical sequences Q9FM59
NP_200391.1.80155 3702.AT5G55800.1-P AT5G55800.1 AT5G55800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]