SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G57380.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G57380.1
Domain Number 1 Region: 318-406
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000114
Family Fibronectin type III 0.0063
Further Details:      
 
Weak hits

Sequence:  AT5G57380.1
Domain Number - Region: 149-205
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0048
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G57380.1
Sequence length 620
Sequence
MQAASLSKIWRFDGNVGPENMDSSSFEDNECIETCKPNVLNVSERRELIHALSNQPEEAS
ELLNSWSRNEIMKIICAEMGKERKYTGLNKPKLIENLLNLVSRPLGETSCSDRRNSRKKE
KKMIGYIICCENLACRAALGCDDTFCRRCSCCICQKFDDNKDPSLWLTCDACGSSCHLEC
GLKQDRYGIGSDDLDGRFYCAYCGKDNDLLGCWRKQVKVAKETRRVDVLCYRLSLGQKLL
RGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMARGIVNRLSSGVHVQKLCSQAMEALD
KVVSPSESVSGQGDKMTVRVEEIQARSVTVRVDSEEPSSSTQNKITGFRLFCRKSKDEEC
SSQGNCVVYLPETTSAIQGLEPDTEFCLRVVSFNEEGDLDESELRFTTLKDDGDEAGDQQ
SPLTNSSSGLCSNPSLPEDESNNVNKSCSKGNGDKDNTEHCSAGEVESELEEERLVKRKA
NKIDGRDLLVTPCKRDIYKGKQGGNKRFKSRTVSLNEKPEINNAANGVGDKDLGHIVKTI
RCLEEEGHIDKSFRERFLTWYSLRATHREVRVVKIFVETFMEDLSSLGQQLVDTFSESIL
SKRSSTNGVVPAGICLKLWH
Download sequence
Identical sequences A0A178UF19 Q9FIE3
NP_200548.2.80155 AT5G57380.1 3702.AT5G57380.1-P AT5G57380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]