SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G58610.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G58610.1
Domain Number 1 Region: 692-742
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000124
Family PHD domain 0.003
Further Details:      
 
Domain Number 2 Region: 863-951
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000201
Family N-acetyl transferase, NAT 0.026
Further Details:      
 
Weak hits

Sequence:  AT5G58610.1
Domain Number - Region: 738-793
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0031
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G58610.1
Sequence length 1065
Sequence
MGLFDCRVYRVFHFLNLLSNFGFFSRSLEEGSLGSWYLGTVTSAKKRRRRCIRYDNILSD
DGSGNLVETVDVSDIVEGLDDCTDVSDTFRGRLRPVPPKLDVAKLNLAYGLCVDVFFSDA
WWEGVLFDHENGSEKRRVFFPDLGDELDADLQSLRITQDWNEATETWECRGSWLFLDLIE
IYKEYNYLPVSVKQLWYDIRDRIGFVRIQEWTCSTKHLWQDLMLGVIEDNLKITIDQFLH
DFDAERYPQLKLLNEASQAVYETNACLSGMLTIAPQEHQFSCIDKDFKPASQRCQSLSVL
TSVSGIRSEASDINKATEISSKKSTAAHKKDILHKKPGIWHPFDCLAKSGPQAVSSFIRS
PLLPMAMHVRMHLKYMGWTIEHMVDEAGRQRFRYLSPNGRLKEHSLRQVCFRLKQPDKSL
TTPGMANPPSLSSENQTYSTQEMRSIVLALPAFNRSVALGEGLKLSTDTLLEYETQGNEE
VFTRESRNFCPKKAFPGQKETLRVRIEPKTKAQGIILRLKSKRKQTPKKDEVIVGLQNVN
RSMRRGHTSKKLMDIKNRVTSRGKTRVLRSRKRAQRVITPISRKHSPRNILSWLMDNNVV
LPRENIRCCNQKDTTVRKEGKLTREGIKCSCCRRVFTINGFEVHANGASCSGAANIFLDD
GRSLLECQVEAYKKRKKAQPPDMLKMKLRQGENDVFCSVCHYGGKLILCDGCPSAFHANC
LGLEDVPDGDWFCQSCCCGACGQFFLKTTSTNAKEEKFISCKQCELKYHPSCLRYDGACD
SLDKILGEKWFCSKDCEESLEPNMYGDDASKIEAAAENHCILSVALDVMHELFEPVKRPH
GGRDLAEDVIFSRWSKFKRLNFSGFYTVLLERNNELVSVATVRILGKKVAEMPFIGTRFQ
HRQRGMCRVLINELEKVLIDLGVERLVLPAVPCVLNTWINSFGFTKMTISERKNFLKFTL
LEFGRTILCEKILIKSGVADPIPSIASLGEQQCDILRIEDNSASDDGSEVHQAEQHLEES
RSTKNPPEYVVQTLTPLHHNPKTPTTRKKKHDTNALHGSWERTNT
Download sequence
Identical sequences F4KGA3
AT5G58610.1 NP_200669.1.80155 AT5G58610.1 3702.AT5G58610.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]