SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G59800.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G59800.1
Domain Number 1 Region: 161-281
Classification Level Classification E-value
Superfamily DNA-binding domain 1.28e-19
Family Methyl-CpG-binding domain, MBD 0.0099
Further Details:      
 
Domain Number 2 Region: 111-160
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000258
Family Methyl-CpG-binding domain, MBD 0.013
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000085
Family Methyl-CpG-binding domain, MBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G59800.1
Sequence length 306
Sequence
MQTRSSSSPSANHRRETQLQIADPTSFCGKIMPGWTVVNRPRSSNNGVVDTYFIEPGTGR
QFSSLEAIHRHLAGEVNDRRLTRAGSFFQDKTRVYEGSRTKQDHCGVEYASKGFRLPRGW
SVEEVPRKNSHYIDKYYVERKTGKRFRSLVSVERYLRESRNSIEQQLRVLQNRRGHSKDF
RLPDGWIVEEKPRRSSSHIDRSYIEPGTGNKFRSMAAVERYLISVGNITLDSVSMVHSER
LPLLMNRNGIRFQSEVIDPNPPKKVKWVLTGSGGNMFTANVRGSNVSSLVKHTWSEAFVS
LIEDRS
Download sequence
Identical sequences Q9FJF4
AT5G59800.1 3702.AT5G59800.1-P NP_200788.1.80155 AT5G59800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]