SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G60142.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G60142.1
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.00045
Further Details:      
 
Domain Number 2 Region: 247-345
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000922
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G60142.1
Sequence length 346
Sequence
MMNRGISVDDCLPKFFKVYLPDDSGDDLELPISFNSFLPKSLPKNVIVRSIYGNIWKVAF
RKFCGDSERFVMVNGWKKIVKDEDLKGGEFLEFEFDGSWCFNFCIYGRATCKRLRSSVQI
TVLDDNDDGFNDDQDYGEEVKSSENFIVLDDDDISDVQDYNEEDTSSEDITALDDADNDD
INDVQDYVEEDTSSEDIIVIDDDDDDDDQDYGDDDHADVEKERWRGVKTEKKKKGSSGEH
DRQYLDNHMNPFFTVNQHRQIKYNMLRIPTKVITKYGLHFPEFINLIDPLEKNFGKLKRK
VKGQTIKGFRSIIRRNNVKLNDKVICELEKEMDGLVREIKVHVIRG
Download sequence
Identical sequences Q9LST3
AT5G60142.1 AT5G60142.1 NP_001119463.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]