SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G61110.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G61110.1
Domain Number 1 Region: 21-79
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000226
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G61110.1
Sequence length 161
Sequence
MADESGYDAGSDAGSDASLPSSEISFVEVKKPCEVCGSNANDHAIMTCFLCRDTREHIYC
ARVHLRSVPRMWICEECRMNPVVVNNVAPVDQEAAASSSRITYQVADSEVVNQTMTSSDS
GNQISATHQQPPQAHASPVAVPMDTSSSDNQQPPSDSESAI
Download sequence
Identical sequences Q9FNQ4
3702.AT5G61110.1-P AT5G61110.1 AT5G61110.1 NP_200919.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]