SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G61120.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G61120.1
Domain Number - Region: 9-60
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0048
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G61120.1
Sequence length 426
Sequence
MAALNLSKRSICETCGHQGWKNSLVTCSKCRIACEHCYCMRESSFETSIHFVCADCSMRP
VQNKFTSDSIKGVPRSIRNKVRVESSNPVPKWKKIPETSRMKLISPEEVKKLACGGSTSK
PTFRVPRPVSARPPMGLTKPTAGFPRARSLNSTVVARKTKSIYLPPKKVEPLSPRTQQIR
PGVMRQASKAQAVGEGSKSKVGDGAKYHDSNEICRSILSEKLLQLLPYRPALHPIWKGRI
VDSATPSEFNGEFLAQPASKVRGKAYILSKAIPVLLKVKLVPIGNLLSGLFMNRKPGLSD
VEMYIFPDDKNTKRFTAERDHIFEAMRIRNAMMKFNINGTPLLIFSSKLLDKSSQIIIKM
QKKTNNFLWGIFLLTKKSLALLPGTSNQTPQHFDDGYVVDNDTEPFFRRYHRNCGKQLQR
HYGQRD
Download sequence
Identical sequences F4K200
AT5G61120.1 AT5G61120.1 NP_200920.3.80155 3702.AT5G61120.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]