SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G61980.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G61980.1
Domain Number 1 Region: 6-241,286-311
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.77e-62
Family BAR domain 0.001
Further Details:      
 
Domain Number 2 Region: 498-638
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.11e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00029
Further Details:      
 
Domain Number 3 Region: 289-329,370-438
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-23
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 733-814
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.24e-20
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G61980.1
Sequence length 828
Sequence
MHFAKLDDSPMFRQQMQSMEESAELLRLRCLRFYKGCRKYTEGLGEGYDADIGFVNALES
FGGGHNDPVCVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLSDRLLQFVNGDVHEVKE
ARKRFDKATITYDQAREKYLSLRKSTRLDVAATIEEDLHSARTTFEQARFHLVSALSNAE
SKKRFEFLEAVSGTMDAHLRFFKQGYELLHQMEPFINQVLAYAHQSRECANYEMASLNER
MQEYQRQVDRETRNSCVSPTGDGMRHNSRNSQKVIEAVMQSAAKGKVQTIRQGYLSKRSS
NLRGDWKRRFFILDSRGMLYYYRKPWNWSSGNGSRSVVHRNMASENSPGLLSRWLSSHYH
GGVHDEKPVARHTVNLLTSTIKVDADQTDLRFCFRIISPTKVYTLQAENAQDQMDWIEKI
TGVIASLLSFQTPERAIMRLSTVDGGDTFSASDSGSLADPYDIEQAESGESTVEHPMTGG
NRSRFSGCLQQHDMVKTEKPIDVLTRVLGNERCADCGAPEPDWASLNLGVLICIECSGIH
RNLGVHISKVRSLTLDVKVWEPSVLTLFQSLGNVYVNSVWEELLNSESRTSSASRSSGTP
KSDRPRKLLVRKPGFNDPISVKELFIHAKYSERIFVRKAIDSQHFQAVFQEIWENVRAND
KKSVYRHIVCSEADVNALRGQASYTVSLPLSKMMQMEETLEAKFKSIEEEFQENPAGYSN
SRGDGESMVREETSNDCSLLHLACLSADIGMVELLLQYGAKINATDSKGRTPLHHCIISR
RYAIARLLLMRGGDPNAVDKDSNIPVKYASQTDLNDSELIALLTDSKR
Download sequence
Identical sequences A0A178ULW4 Q9FIT8
AT5G61980.1 AT5G61980.1 NP_201004.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]