SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G62290.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G62290.2
Domain Number - Region: 25-78
Classification Level Classification E-value
Superfamily PH domain-like 0.00135
Family VPS36 N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G62290.2
Sequence length 228
Sequence
MVAGLRDFTLRTEDGSGKPVLDESNGEELMHVQTSVAVALGNRPIESPGTLYITSRKLIW
LSDVDMAKGYAVDFLSISLHAVSRDPEAYSSPCIYTQIEVEEDEDDESDSESTEVLDLSK
IREMRLVPSDSTQLETLFDVFCECAELNPEPVQEEEESGHNWVFSADQMDVRGGDDDAEW
QISQSPTSVIGHSNGDEGLNQPMLELQINDQRFEDAEEMVHESETKDH
Download sequence
Identical sequences NP_001119478.1.80155 AT5G62290.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]