SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G63700.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G63700.1
Domain Number 1 Region: 249-344
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.64e-23
Family SWIB/MDM2 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 402-521
Classification Level Classification E-value
Superfamily Plus3-like 0.0000000000000196
Family Plus3 0.008
Further Details:      
 
Domain Number 3 Region: 17-78
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000288
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G63700.1
Sequence length 602
Sequence
MARDMNVVEILDDEEEDEKECEDWCFICKDGGNLMLCDFKDCPKVYHESCVEKDSSASKN
GDSYICMWHSCYLCKKTPKLCCLCCSHAVCEGCVTHAEFIQLKGDKGLCNQCQEYVFALE
EIQEYDAAGDKLDLTDRNTFECLFLEYWEIAKKQEGLTFDDVRKVCASKPQKKGVKSKYK
DDPKFSLGDVHTSKSQKKGDKLKNKDDPKFALGDAHTSKSGKKGVKLKNKDDPKFLVSDH
AVEDAVDYKKVGKNKRMEFIRWGSKPLIDFLTSIGEDTREAMSQHSVESVIRRYIREKNL
LDREKKKKVHCDEKLYSIFRKKSINQKRIYTLLNTHLKENLDQVEYFTPLELGFIEKNEK
RFSEKNDKVMMPCKKQKTESSDDEICEKEVQPEMRATGFATINADNLKLVYLRKSLVLEL
LKQNDSFVDKVVGSFVKVKNGPRDFMAYQILQVTGIKNADDQSEGVLLHVSGMASGVSIS
KLDDSDIREEEIKDLKQKVMNGLLRQTTVVEMEQKAKALHYDITKHWIARQLNILQKRIN
CANEKGWRRELEEYLEQRELLEKPSEQERLLKEIPRIIEDFIEIKQEPCVGGLSHEAVIN
ID
Download sequence
Identical sequences A0A178U8L2 F4KAT5
AT5G63700.1 NP_201175.2.80155 AT5G63700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]