SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G10960.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G10960.1
Domain Number 1 Region: 36-144
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.65e-35
Family 2Fe-2S ferredoxin-related 0.0000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G10960.1
Sequence length 148
Sequence
MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI
TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQ
MSEGYVLTCVAYPTSDVVIETHKEEAIM
Download sequence
Identical sequences A0A178WLN7 O04090
AT1G10960.1 NP_172565.1.80155 AT1G10960.1 3702.AT1G10960.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]