SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G35240.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G35240.1
Domain Number 1 Region: 123-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-28
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 494-571
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000108
Family PB1 domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G35240.1
Sequence length 590
Sequence
METGNVVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGENVYYFPQGNIELVDAS
TREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQSENQFR
PLVNSFTKVLTASDTSAYGGFFVPKKHAIECLPPLPLPAQELLAKDLHGNQWRFRHSYRG
TPQRHSLTTGWNEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCM
RHGVIASAKHALDNQCIFIVVYKPSIRSSQFIVSYDKFLDAMNNKFIVGSRFTMRFEGDD
FSERRYFGTIIGVNDFSPHWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLMSALNVPR
SSLLKNKRLREVNEFGQEIGQLSVASPMNTSLRYRDTTEDAMNPSRLLMSYPVQPMPKLN
YNNQMVTQIEENITTKAVTNFRLFGVSLAIPLVIKDPIEEIGSDISKLTEGKKFGQSQTL
RSPIEIQSKQFGSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRN
QWKIAFTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSLSS
Download sequence
Identical sequences Q9C7I9
3702.AT1G35240.1-P AT1G35240.1 AT1G35240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]