SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G35520.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G35520.1
Domain Number 1 Region: 129-239
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-30
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 513-595
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000746
Family PB1 domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G35520.1
Sequence length 598
Sequence
METGNVVNAQPELSGIIDRSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGNIELVEAS
TREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAKITLMPDTTVSENLQVVIPTQN
ENQFRPLVNSFTKVLTASDISANGVFSVPKKHAIECLPPLDMSQPLPAQELLAIDLHGNQ
WSFRHSYRGTPQRHLLTTGWNEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIP
SSIVSIDCMRHGVIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDAVNNKFNVGSRFT
MRFEGDDLSERRYFGTIIGVSNFSPHWKCSDWRSLEVQWDEFASFLRPNKVSPWEIEHLM
PALNVPRSSFLKNKRLREVNEFGSSSSHLLPPILTQGQEIGQLSVASPMNISLLYRETTE
DAMNPSRLLMSYPVQPMPKRNYNNQMVTQIEENITTKAGTNFRLFGVSLATPPVIKDPIE
QIGSDISKLTEGKKFGQSQTLRSPTKIQSKQFSSTRTCTKVQMQGVTIGRAVDLSVLNGY
DQLILELEKLFDLKGQLQTRNQWKIIFTGSDEDEMLVGDDPWPEFCNMVKRIYIQKRR
Download sequence
Identical sequences 3702.AT1G35520.1-P AT1G35520.1 AT1G35520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]