SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G35540.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G35540.1
Domain Number 1 Region: 123-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-30
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 507-586
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000608
Family PB1 domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G35540.1
Sequence length 605
Sequence
MESGNVVNTQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVEAS
TREELNELQPICDFPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNQNQFR
PLVNSFTKVLTASDTSVHGGFSVPKKHAIECLPPLDMSQPLPTQEILAIDLHGNQWRFRH
IYRGTAQRHLLTIGWNAFTTSKKLVEGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIVS
IESMRHGIIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDVVNNKFNVGSRFTMRFEG
DDFSERRSFGTIIGVSDFSPHWKCSEWRSLEVQWDEFASFPRPNQVSPWDIEHLTPWSNV
SRSSFLKNKRSREVNEIGSSSSHLLPPTLTQGQEIGQQSMATPMNISLRYRDITEDAMTP
SRLLMSYPVQPMAKLNYNNVVTPIEENITTNAVASFRLFGVSLATPSVIKDPVEQIGLEI
SRLTQEKKFGQSQILRSPTEIQSKQFSSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILE
LEKLFDLKGQLQARNQWEIAFTNNEEDKMLVGEDPWPEFCNMVKKIFIYSKEEVKNLKSR
KSLSS
Download sequence
Identical sequences Q9LQE8
3702.AT1G35540.1-P AT1G35540.1 GO.4003 NP_174786.1.80155 AT1G35540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]