SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G48970.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G48970.1
Domain Number 1 Region: 314-659
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.17e-89
Family IF2B-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G48970.1
Sequence length 666
Sequence
MDTRRGALAVPKVRRVGFFTSIEPPPESSLQRPNRSQSGPVDATTSSSPLSDSPSGNLIS
PVLIPPSRHHSDNLTSRVAAAAAAPVPVPGPAAFRRYLTPERTLLHVGSYNPPDSLLGTS
SPSSNGGLSEDSASLFGFQRSDSTKLSASLPNGGFDLTLAVRAPQESETKIATTSASQGK
KKIAEVSGKSESATTKPQKEKEPKALKDKTTKAERRAIQEAQRAAKAAAKGEGSRRADES
GRANPGKAAIKPQPKKERLPVTSSVSEKTAVAVEKEKRMDVPQTQMQYDDKSRVDKAKRR
AVVEQTESKNKVELFLHLPQYERSNQLPNLSSNFFTLDSIHHAVYKVGLQHLAGDISGDN
ARCIAMLQAFQEAIEDYSTPPMKDLTMDLTAKINGYVSFLIECRPLSMSMGNAIRFLKNQ
IRKLPVNLSESEAKSSLCSDIGRFIDEKTIIADKAIVQHAVTKIRDGEVLLTYGFSCVVE
MILLYAHEIGKKFRVVIVDSRPNLEGQKLLRRLVTRGLDCTYTHINAISYIMREATRVFL
GASSIYSNGTLYARVGTSCIAMVANAFSVPVIVCCEAYKFHERVLLDSICSNELGDPDAV
ANIPSFRTNAKHSKTMDNNKNLQFLNLMYDSTPSEYISMIVSDYGMIPPTSIPVIVREYR
RENLLL
Download sequence
Identical sequences A0A178W9M9 F4I048
AT1G48970.1 NP_175327.3.80155 AT1G48970.1 3702.AT1G48970.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]