SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G18810.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G18810.1
Domain Number 1 Region: 111-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000863
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G18810.1
Sequence length 234
Sequence
MVRAFAYEEIGETSTEAHASVEDNKRDRTRRVINYNLRSTTMISSLSKRLKIDECKNQDP
EQNPNRVASSPSLCHVKSKRPQKGVSNKPILDMDFLNEEELEKIDRHYKKISDSDKGADV
ILVNSEGLQRKLKLKRWDMTSTSNYVLGSGWNKVVTENILETGTRLRLWSFHSPDMLFFA
LVLSDPDLAPTKDWECLNLLAKLTVETACLEASQDADTMSSLVSDTELDLELRL
Download sequence
Identical sequences A0A178VYJ3 Q9ZV39
3702.AT2G18810.1-P AT2G18810.1 AT2G18810.1 GO.8598 NP_179471.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]