SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G31720.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G31720.1
Domain Number 1 Region: 146-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000235
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G31720.1
Sequence length 313
Sequence
MVRGDDQLNGLQGGKRALDILCVATERTVSAFAYEEIGETSTEGDKRRERLRRLRRLINY
SLSTTMNSSLSKRLKIDECKNQDPEQNPNRVASSPSSCHLESKRPQKVVSNKPVRNRKPV
IVTDEDRTPTEWLIDVMREVNGMDAKLIFVKVLPNSDVDELQTRLMMPWKQILDMDFLNE
EELEKIDRHHKKISASDKGADVIVVNSKGLQRKLKLKRWDMTSTSNYVLGLGWNKVVTDN
ILQRGTRLRIWSFHSPDMLFFAFVLSDPDPAPTECLNLLAKLCEETTCLEALQEANRMSS
LVSDTELDLELRL
Download sequence
Identical sequences Q8RV83
3702.AT2G31720.1-P AT2G31720.1 NP_180730.1.80155 AT2G31720.1 GO.7439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]