SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G39000.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G39000.1
Domain Number 1 Region: 75-257
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.19e-19
Family N-acetyl transferase, NAT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G39000.1
Sequence length 291
Sequence
MRSTPLGTTAVSPASIKHNSYGYGRFVSSSGVSNFSIHRRRRHSSFSISQAPSQINSGAC
NASQIVDLFPAVSPEIVVREARLEDCWEVAETHCSSFFPGYSFPLDVVLRVDRLMAMVMG
FSIPPGCQRTCLVAVIGSSVDETICFGSDDFKIGAFDAKISLNKGYVAGILTVDTVADYL
PRKGPLRQRRTGIAYVSNVAVRENFRRKGIAKRLIWKAEALAKNWGCRAIGLHCDLNNLG
ATKLYKDQGFRSIKIPEGATWPQPKTSPDTRFTFMMKLVNNNNTQALEQFR
Download sequence
Identical sequences Q9ZV08
AT2G39000.1 3702.AT2G39000.1-P NP_181433.1.80155 AT2G39000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]