SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G45540.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G45540.1
Domain Number 1 Region: 2219-2509
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-123
Family BEACH domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 2631-2701,2739-2853,2880-2927
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.3e-31
Family WD40-repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 2099-2208
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-24
Family PreBEACH PH-like domain 0.0015
Further Details:      
 
Domain Number 4 Region: 447-589
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000594
Family Clostridium neurotoxins, the second last domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G45540.1
Sequence length 2946
Sequence
MEDDDERKLPEADIANPLHNRIEAFDTTLQGISSADRAFKDDDFEQVSLGDQEKAANESQ
GDLQEPGSFSNSDHGRSSFGGTEVVTYQLSGTQEMYDLMPMDDVQSDRLSSPGPEREAAY
SMQQSLSETSLDSVHHPESGYSPVHSPQKPKPKATVPNVSPELLHLVDSAIMGKPESLDK
LKNVVCGIENFGCGEESEATAFLVVDSLIATMGGVESFEEDEDSNPPSVMLNSRAAIVSG
ELIPWLPGLGDNVNFMSPRTRMVRGLLVILRSCTRNRAMCSTAGLLGVLLRSVEAIISKD
VDMKWNAAAILLLCIQHLAGHSLSVDDLHRWLQVIKAAITTAWSSPLMLALEKAMSGKES
RGPACTFEFDGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLNAATAAAAIAAAAAA
KSGKTSAMSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYFHAQFLVVESGSGKGRKS
SLHFTHAFKPQCWYFIGLEHSCKQGLLGKAESELRLYIDGSLYESRPFDFPRISKPLSFC
CIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPERMARLASRGGDVLPCFGNGAG
LPWLATNDYVRNKAEESSILDADIGGYTHLLYHPCLLSGRFCPDASLSGAAGTLRRPAEV
LGQVHVATRMKPVESFWALAYGGPMSLLPLTVSSVHKDSLEPCLGNLPLSLSTVTLAAPV
FRIMSVAIQHPGNNEELCRTQGPEILARILSYLLHSLASLDRKHDGVGEEELVAAIVSLC
QSQKINHVLKVQLFRTLLLDLKIWSLCNYGLQKKLLSSLQDMVFTEATAMRDAEAIQLLL
DGCRRCYWMISEKDSETTFPLDGNTRQMGELNALIDELLVIIELLMGAASPSLAADDLRR
LLGFIIDSPQPNQVARVLHLMYRLVVQPNAARAQMFAEVFITSGGIETLLVLLQREAKTG
EDNVLAMGRSGKRSSTDPSEKSPYNESGSVKQLDSNPHDNEIGFDLPGPDGNSVEDDNVG
SLNVPESVRQEKEHGSTPVVCDSDSVSISNSINTERLSAEIGGISLSISADSARNNVYNV
DNSDAVVVGIIRLIGALISSGHLTFDFDARSDVTSNILGSGLHENGGTMFDDKVALLLFA
LLKAFQAAPNRLMTDNVYTTLLGASINASSTEDGLNFYDSGHRFEHSQLLLVLLRSLPSA
SKALQSRALQDLLFLACSHPENRSSLTTMEEWPEWILEILISNYEKDAGKQSASVGSCEV
EDMIHNFLIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREESLPIFKRR
LFGGLLDFAARELQAQTQVIAAAAAGVAAEGLAPKDAKAGAENAAQLSVFLVENAIVILM
LVEDHLRSQSKQTCATNAVASPSPLKKRTSTLTAIGESSEISSSRASLSSDSGKVPLDIL
ASMADSSGQISAVAMERLTAASAAEPYESVSCAFVSYGSCAMDLAEGWKYRSRLWYGVGL
PSKPSSLGGGGSGSDSWKSTLEKDAHGNWIELPLVKKSVSMLQALLLDESGLGGGLGIGG
GSGTGMGGMTALYQLLDSDQPFLCMLRMVLLSMREEDYGEDNMLMRNLSSERSSGNSVTL
DSGSQMSMRQSRSALLWSVLSPIINMPISDSKRQRVLVTACVLYSEVWHAISRDRRPLRK
QYIEAIVPPFIAVLRRWRPLLAGIHELATADGMNPLVVDDRALAADALPVEGALSMVTPE
WAAAFASPPAAMSLAMIAAGAAGWEAPPPPTPSHLRRDSSMLERKTAKLQTFSSFQKPLE
PPNNNAPPRPRDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNIGDMERLQ
RWNTSEAMGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVASFALARNMQRSEIDRRMQ
DDIIAANRLCLGSRAWRKLIRYLAEMRCFFGPFGDGICSPERVFWKLDSMESFSRMRQSI
RRNYSGTDHHGAAADYDDQTETKSDNGSKGSQSNPPVVAAEVILMEIAYEEDEHGEGDQL
DVKGNAEEHKRDEGRISGSHEHASRTSAGNSDPRTSNDLEMVRDSSVVAPGFVPSELDER
ILLELPTSMVRPLRVVKGTFQITTRRINFIVDNRESQNLADHSDESQSGDQEKDRSWPMS
SLHQIYSRRYLLRRSALELFMVDRSNFFFDFGNTEGRRNAYRAIVQARPPHLNNIYLATQ
RPEQLLRRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWIISDNSSESLDL
SNPSTFRDLSKPIGALNPERLKKFQERYSSFEDPVIPKFHYGSHYSSAGAVLYYLARVEP
FTTLSIQLQGGKFDHADRMFSDFPGTWNGVLEDMSDVKELVPELFYLPEVLTNENSIDFG
TTQLGEKLDAVKLPPWAKNPVDFVHKQRRALESEHVSAHLHEWIDLIFGYKQRGKEAIMA
NNVFFYITYEGTVDIDKITDPVQQRATQDQIAYFGQTPSQLLTVPHMKRMPLKDVLHMQT
IFRNPKEIKPYTVQTPERCNLPASAIQASSDSVVIVDMNVPAARVAQHKWQPNTPDGQGT
PFLFHHGKATTTSTSGSLMRMFKGPASSGTGDWQFPQAQAFASSGIRSSSVIAITSDGEI
ITGGHADNSIKLVSSDGAKTLETAFGHCAPVTCLALSPDNNFLVTGSRDSTVLLWRIHKA
FTSRTSVSEPSTGSGAPSSTSNTNLANTLANKGKKCRLEGPIQVLRGHRRELVCCCVSSD
QGVVVSSSESSDVLLHSIRKGRLIRRLVGVKADSLCISSDGVIMAWSSSEGSISVFTING
VLIAKAKFPLFCSVGCMEISMDGQNALIGMNSCSNSDYSSSNDTSKDSKEIERLDVPSPS
ICFLNLYTLQVFHVLKLGQGQDITALALNVDNTNLLVSTEDKQLIIFTDPALSLKVVDQM
LKLGWE
Download sequence
Identical sequences 3702.AT2G45540.1-P AT2G45540.1 NP_001318429.1.80155 NP_001325311.1.80155 NP_001325312.1.80155 NP_001325313.1.80155 NP_182078.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]