SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G46530.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G46530.2
Domain Number 1 Region: 22-166
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-39
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 398-479
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000641
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G46530.2
Sequence length 514
Sequence
MRPMRFTLRSHYNQKKIEPTSLDPPLVEPAKPTVDSFVKILTASDTSTHGGFSVLRKHAT
ECLPSLDMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDA
FVFLRGETGDLRVGVRRLAKQQSTMPASVISSQSMRLGVLATASHAVTTTTIFVVFYKPR
ISQFIISVNKYMMAMKNGFSLGMRYRMRFEGEESPERIFTGTIIGSGDLSSQWPASKWRS
LQIQWDEPSSIQRPNKVSPWEIEPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFL
SSFSQSHESNPSVKLLFQDPATERNSNKSVFSSGLQCKITEAPVTSSCRLFGFDLTSKPA
SATIPHDKQLISVDSNISDSTTKCQDPNSSNSPKEQKQQTSTRSRIKVQMQGTAVGRAVD
LTLLRSYDELIKELEKMFEIEGELSPKDKWAIVFTDDEGDRMLVGDDPWNEFCKMAKKLF
IYPSDEVKKMRSKSLLGDKGTIVNLESDQRTVHV
Download sequence
Identical sequences NP_973701.1.80155 AT2G46530.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]