SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G46530.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G46530.3
Domain Number 1 Region: 130-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-39
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 506-587
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000085
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G46530.3
Sequence length 622
Sequence
MSQTSLEPLIISIIKLQILQLWLKLIAVGWNLGSNDDELYTELWKACAGPLVEVPRYGER
VFYFPQGHMEQLVASTNQGVVDQEIPVFNLPPKILCRVLSVTLKAEHETDEVYAQITLQP
EEDQSEPTSLDPPLVEPAKPTVDSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQPT
PTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGETGDLR
VGVRRLAKQQSTMPASVISSQSMRLGVLATASHAVTTTTIFVVFYKPRISQFIISVNKYM
MAMKNGFSLGMRYRMRFEGEESPERIFTGTIIGSGDLSSQWPASKWRSLQIQWDEPSSIQ
RPNKVSPWEIEPFSPSALTPTPTQQQSKSKRSRPISEITGSPVASSFLSSFSQSHESNPS
VKLLFQDPATERNSNKSVFSSGLQCKITEAPVTSSCRLFGFDLTSKPASATIPHDKQLIS
VDSNISDSTTKCQDPNSSNSPKEQKQQTSTRSRIKVQMQGTAVGRAVDLTLLRSYDELIK
ELEKMFEIEGELSPKDKWAIVFTDDEGDRMLVGDDPWNEFCKMAKKLFIYPSDEVKKMRS
KSLLGDKGTIVNLESDQRTVHV
Download sequence
Identical sequences Q9ZPY6
3702.AT2G46530.3-P GO.6660 AT2G46530.3 NP_001031548.1.80155 AT2G46530.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]