SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G06160.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G06160.1
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-21
Family B3 DNA binding domain 0.00022
Further Details:      
 
Weak hits

Sequence:  AT3G06160.1
Domain Number - Region: 242-318
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000235
Family B3 DNA binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G06160.1
Sequence length 330
Sequence
MWATKSRRCAVHTSSMASGDVLPRFFTVFLSHCSSESMVIPRSYYNLLPRPLPKTAILIG
TGGRFWKVAMTSKQEQVYFEQGWGNFVADNQLKEGEFLTFVFDGHKSYEVSIYGRGDCKE
TRAVIQVEEISDDTEDDNVSLHSPSNVSLDSLSNDSHHSTSNVSLRSLSNDSLHGDAEIE
SDSEYSPENLPSASISVESVEVVNPTTSRQRSYKRKTIENPHLYLDDPNNVCFETCLKLR
KFELLVHAQLVKDYGLIFSDNVDYIDGYGKLTAKTTKWADQRVCINKWQKICERNQFTEN
DSILCEILRNEDKVVYAIKIHIFRDAAAST
Download sequence
Identical sequences Q9M8K2
NP_187267.1.80155 AT3G06160.1 3702.AT3G06160.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]