SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G07300.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G07300.3
Domain Number 1 Region: 4-95,178-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-84
Family IF2B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G07300.3
Sequence length 409
Sequence
MPDVQSTVVEFVNKLRKRKIEGSQATAKYTVELLRSVISHQRVPHANQAAALIDAVKAVG
EQLIAANPVELAVGNVVRRVLHIIREEDLSLTTAAMGGLDLLDASDDDDVDNCKGIGFPA
MSAAVVAAAARSTLRPPSLQTLLEGTPESATVPYTSSSGADSESKSKSADKSSLTRKLKH
DVIEGVNQLIQEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVF
VAEGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVG
VNMAALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGAG
SGSLQVVNPTFDYVPPNLVSLFITDTGGHNPSYMYRLIADYYSADDLVM
Download sequence
Identical sequences B3H7H1
AT3G07300.3 3702.AT3G07300.3-P NP_001319491.1.80155 AT3G07300.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]