SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G17010.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G17010.1
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-20
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 198-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-18
Family B3 DNA binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G17010.1
Sequence length 302
Sequence
MGKSSNIVFDRIKEERQMLSFFKIFQRADLSSDCMRALPYSFISKVSEKDFSYKMVIRAQ
WGKTWDVEVSKNPTYYYIETRGWDLFVSDNALGQNEFITFTHRGNMVFHVNIYEQNGLEM
RKPRKFQTMGPSSGIKKEEGENSLIDVKKEEESDESPGRAEFLVRKKKTEDSKSSKKKMT
RNKVKKKSKSKSKQVLDGVPEFKITIRKSYLKFLAIPKHFVDDHIPNKSKIFTIRHPNGG
SWKVLCLVREIRTIFSGGYSKLAREFPLMVGDKCTFKLIKPFEFVLLTSKKNREKMDQCM
ID
Download sequence
Identical sequences A0A178VKY2 Q9LSP6
NP_188326.1.80155 AT3G17010.1 3702.AT3G17010.1-P AT3G17010.1 GO.12242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]