SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G46770.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G46770.1
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000188
Family B3 DNA binding domain 0.00079
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000334
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G46770.1
Sequence length 276
Sequence
MEENSSKKKLSETMSIQDTVLKFFRVYIPNQTADDMNLPLVSDKISGKPLPRKVTVKSVS
SGNIWRMEMKANGNTVFLRDGWKKIVKDENVTEPIFLEFEFDGYGVFHFCVYEYGSMCKR
MRSPMEKEVIKVDSEEDVLVGNEESTKGLEESPRRGGTSRRRAKLKTKSHKIYEHLDNKL
NPSFPVDMTQNRTRIPSLLIKDYNLTFPNMVIMRDKIGILKRRIVIWKNRSVYLNGIGSI
IRRNHVKPGNEVVFELKMVNGYHGLVHEIKVHIIKA
Download sequence
Identical sequences Q9STF1
3702.AT3G46770.1-P AT3G46770.1 AR1299 NP_190261.1.80155 AT3G46770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]