SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G56580.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G56580.2
Domain Number 1 Region: 167-232
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-20
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Weak hits

Sequence:  AT3G56580.2
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0331
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G56580.2
Sequence length 320
Sequence
MSSIRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAF
SAFMRSRLAERSYDREISGRLGSAGSESFSNLAPLLIFGGQAPFRLAGGDNSSVEAFVNG
AAPGIGIARGTNAGDYFFGPGLEELIEQLSSGTHHRGPPPAPKSSIDALPTIKITQKHLK
SSDSHCPVCKDEFELKSEAKQMPCHHIYHSDCIVPWLVQHNSCPVCRKELPSRGSSSSTQ
SSQNRSTNGRENSRRRNIFSNLWPFRSSSSSSTQNRRDTNNTATAEEGHYHHHQQQQQQH
QHQHQQQQSHMGYSGWPFDY
Download sequence
Identical sequences Q94AK4
3702.AT3G56580.3-P AT3G56580.1 NP_001030874.1.80155 NP_567039.1.80155 NP_974448.1.80155 AT3G56580.1 AT3G56580.2 AT3G56580.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]