SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G02870.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G02870.1
Domain Number 1 Region: 191-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000051
Family B3 DNA binding domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G02870.1
Sequence length 310
Sequence
MTLSDDPISPSTQESSNSSYVRSKEAEKNSPSQETDEEVLKGYESYRENPSNYDNDNILI
YTDTFNLYDDMFEGSLDSTRNFGAQKDPNVLVMQRLLHNSGSLIGVDMEQDGIDLATLFA
DSTEDSKLPYVIYEGLEMQGEGYGTNTRGPFENKIDIGSFGKSGSVMNVEREKEKIVMIP
TPRFGNATPQWTIKKKLSSYDIRPRCGRLILQSSSFNEHIGRHLPKDQMIKINVGVNVNV
YDYDTGTLHELRLEYQRQYGLAHGWQEDFVRRRHLKQKDEIGLLWDFSSSRLQFGVISRN
TGPGLWETKD
Download sequence
Identical sequences Q9SY12
AR1445 GO.18600 NP_192196.1.80155 AT4G02870.1 AT4G02870.1 3702.AT4G02870.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]