SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G22745.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G22745.1
Domain Number 1 Region: 91-200
Classification Level Classification E-value
Superfamily DNA-binding domain 5.23e-22
Family Methyl-CpG-binding domain, MBD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G22745.1
Sequence length 204
Sequence
MLPFPAMNLKKSRSENSSVASSGSKIEEQTEKSAEPTTIKVQKKAGTPGRSIDVFAVQCE
KCMKWRKIDTQDEYEDIRSRVQEDPFFCKTKEGVSCEDVGDLNYDSSRTWVIDKPGLPRT
PRGFKRSLILRKDYSKMDAYYITPTGKKLKSRNEIAAFIDANQDYKYALLGDFNFTVPKV
MEETVPSGILSDRTPKPSRKVTID
Download sequence
Identical sequences A0A178UWM3 Q5XEN5
NP_567667.2.80155 3702.AT4G22745.1-P AT4G22745.1 AT4G22745.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]