SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G23860.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G23860.1
Domain Number 1 Region: 115-206
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000921
Family PHD domain 0.0048
Further Details:      
 
Weak hits

Sequence:  AT4G23860.1
Domain Number - Region: 43-77
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0628
Family Di-heme elbow motif 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G23860.1
Sequence length 452
Sequence
MASGVFEDEAEGTITINEYIERLDAEELAADLVLGGDEGDECTFPKGYMKRQAIFSCITC
TPEGNAGICTACCLSCHDGHELLELWTKRNFRCDCGNSKFGTLACKLLPSKDIENSENSY
NHNFKGLYCTCDRPYPDPNVEEQVEMIQCCLCEDWFHEEHLGLTPSDSVGSQIPRDEESE
PIYEDFICQNCSPACSFLTLYPENLWVVAKVDSTGSANACSETIELDKNHMDSEPGQPEN
GTDAEKSVVGKCSETISDSEPGQPENGTEAEKSVVQKCSEKIDESEAGQPENSTEAEKFV
VRKCSEKIDGSENVPAAGCVIRTDLNSCPEFEKKPLFLTKNWRNILCRCEKCLEMYKQRK
VSYLLDAEDTIVEYEKKAKEKRTEKLEKQEGEALDLLNNLDHVSKVELLHGIKDFQDGLQ
GLMESAGPSKAITSADIEQMFSKLKNKRKRME
Download sequence
Identical sequences C0SVJ2
NP_001078436.1.80155 NP_194117.3.80155 NP_974600.1.80155 AT4G23860.1 AT4G23860.1 AT4G23860.2 AT4G23860.3 3702.AT4G23860.3-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]