SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G31630.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31630.1
Domain Number 1 Region: 163-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000687
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 305-401
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000942
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G31630.1
Sequence length 512
Sequence
MADPLIPSPTNKAFFIIDLSGQKSNPIIPTEFIWNHFNGKIQSTNMKLTSDASDRNWDVK
LDGARFAGGWKDFSVSHSVRDDDLLSFRHDGGMVFHVSPFGRSFSQIQLISSSTSDDDDD
ERTVFDDDEDDDVGDDDDNSISEDDFCSKKISSKKRARKETESSSDKSYLVAHVTPSSLL
RDNMCVLSKFARSNGLDRRECEIDLRDEHEKSWTLLLRHNKKTGQAFMRGGWRSFCRNNG
IKAGSICRFKLVQSGIKPVLQLCPNASSIPEGNSSKARKKRNVSEIEGDEIESENCSETI
PLNQNKILTFDLKPYVFRSCQFFLPASFARENGIVEAGEVTVLNKDGIEWKSHLVNIKGR
DQFYNRGCQDFFVANGVKNVGDPFTLEVIRGGPSPILKICSKVKQAASSDGHKTADRKPR
MTDQAPLAEEQTDNRVEKRAQVTEEGGPSRSTRADPGNLQQKQPCSISDHVKKVKQSIVD
TLTDVRRFQSELKVKEQNLEASLQEIDALGMI
Download sequence
Identical sequences Q9SB79
NP_194891.1.80155 3702.AT4G31630.1-P AT4G31630.1 AT4G31630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]