SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G31680.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G31680.1
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-23
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 143-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-21
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 249-347
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000049
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT4G31680.1
Sequence length 462
Sequence
MANASQLSPTNKHFFKPLLPGFQRNLNIPVKFFSEHIEGKHEGETVKLRADASKRTWEVK
MDGNRLTEGWKEFVEAHDLRIRDFVVFRHEGDMVFHVTALGPSCCEIQYPQSISHEEGEE
SGEVEISEREVEENLQKEYDQSSADLNCFSQSVTHSNISNDLVTLPRDFAKRNGLDKGMH
EIVLMNEEGKSWESEVRSRMSGQVFIVGGWKSLCSENKLKGGDSCTFKLLQNAKTPVFQL
CSRIGESRFVKLTPTLNSLEIGKQHLPVSFTKGNGLIHPGEIILVDKDRVEWSMKLQVDN
RGGMHIFGGNDWKSFCAANEVGAGESLTLELIRGGLSPLFKFFSKIEQPSFEAEDRRHKR
ARVHNGSQETDKGEPSRATKMGPELEKREKTAEKGEPSRASNKSSGKQGNLQKTQACSVT
DHVAKVKESVVDTLTSIRRFQAELETMEQKLEDSLQEINKLS
Download sequence
Identical sequences Q8H2D1
3702.AT4G31680.1-P NP_194896.2.80155 AT4G31680.1 AT4G31680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]