SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT4G32010.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G32010.1
Domain Number 1 Region: 283-386
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-20
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT4G32010.1
Sequence length 780
Sequence
MESIKVCMNALCGAASTSGEWKKGWPMRSGDLASLCDKCGCAYEQSIFCEVFHAKESGWR
ECNSCDKRLHCGCIASRFMMELLENGGVTCISCAKKSGLISMNVSHESNGKDFPSFASAE
HVGSVLERTNLKHLLHFQRIDPTHSSLQMKQEESLLPSSLDALRHKTERKELSAQPNLSI
SLGPTLMTSPFHDAAVDDRSKTNSIFQLAPRSRQLLPKPANSAPIAAGMEPSGSLVSQIH
VARPPPEGRGKTQLLPRYWPRITDQELLQLSGQYPHLSNSKIIPLFEKVLSASDAGRIGR
LVLPKACAEAYFPPISLPEGLPLKIQDIKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSM
QLQAGDTVTFSRTEPEGKLVMGYRKATNSTATQMFKGSSEPNLNMFSNSLNPGCGDINWS
KLEKSEDMAKDNLFLQSSLTSARKRVRNIGTKSKRLLIDSVDVLELKITWEEAQELLRPP
QSTKPSIFTLENQDFEEYDEPPVFGKRTLFVSRQTGEQEQWVQCDACGKWRQLPVDILLP
PKWSCSDNLLDPGRSSCSAPDELSPREQDTLVRQSKEFKRRRLASSNEKLNQSQDASALN
SLGNAGITTTGEQGEITVAATTKHPRHRAGCSCIVCSQPPSGKGKHKPSCTCTVCEAVKR
RFRTLMLRKRNKGEAGQASQQAQSQSECRDETEVESIPAVELAAGENIDLNSDPGASRVS
MMRLLQAAAFPLEAYLKQKAISNTAGEQQSSDMVSTEHGSSSAAQETEKDTTNGAHDPVN
Download sequence
Identical sequences Q5CCK4
NP_194929.2.80155 3702.AT4G32010.1-P AT4G32010.1 AT4G32010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]